GBF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12539S
Artikelname: GBF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12539S
Hersteller Artikelnummer: CNA12539S
Alternativnummer: MBL-CNA12539S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human GBF1 (NP_004184.1).
Konjugation: Unconjugated
Alternative Synonym: CMT2GG, CMTDI2, CMTDIA, ARF1GEF
Klonalität: Polyclonal
Molekulargewicht: 206kDa
NCBI: 8729
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MVDKNIYIIQGEINIVVGAIKRNARWSTHTPLDEERDPLLHSFGHLKEVLNSITELSEIEPNVFLRPFLEVIRSEDTTGPITGLA
Target-Kategorie: GBF1
Application Verdünnung: WB: WB,1:500 - 1:2000