COX2/PTGS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1253P
Artikelname: COX2/PTGS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1253P
Hersteller Artikelnummer: CNA1253P
Alternativnummer: MBL-CNA1253P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 18-111 of COX2/PTGS2 (NP_000954.1).
Konjugation: Unconjugated
Alternative Synonym: COX2, COX-2, PHS-2, PGG/HS, PGHS-2, hCox-2, GRIPGHS
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 5743
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: ANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLID
Target-Kategorie: PTGS2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200