HDAC3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12542S
Artikelname: HDAC3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12542S
Hersteller Artikelnummer: CNA12542S
Alternativnummer: MBL-CNA12542S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human HDAC3 (NP_003874.2).
Konjugation: Unconjugated
Alternative Synonym: HD3, RPD3, KDAC3, RPD3-2
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 8841
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Target-Kategorie: HDAC3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200