Tyrosinase Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1254P
Artikelname: Tyrosinase Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1254P
Hersteller Artikelnummer: CNA1254P
Alternativnummer: MBL-CNA1254P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Tyrosinase (NP_000363.1).
Konjugation: Unconjugated
Alternative Synonym: ATN, CMM8, OCA1, OCA1A, OCAIA, SHEP3
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 7299
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: FAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRDAEKCDICTDEYMGGQHPTNPNLLSPASFFSSWQIVCSRLEEYNSHQSLCNGTPEGPLRRN
Target-Kategorie: TYR
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200