[KO Validated] ABCF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12555S
Artikelname: [KO Validated] ABCF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12555S
Hersteller Artikelnummer: CNA12555S
Alternativnummer: MBL-CNA12555S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human ABCF2 (NP_005683.2).
Konjugation: Unconjugated
Alternative Synonym: ABC28, HUSSY18, HUSSY-18, EST133090
Klonalität: Polyclonal
Molekulargewicht: 71kDa
NCBI: 10061
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNSGRRYGLIGLNGIGKSMLLSAIGKREVPIPEHIDIYHLTREMPPSDKTPLHCVMEVDTERAMLEKEAERLAHEDAECEKLMELYERLEELDADKAEMRASRILHGLGFTPAMQRKKLKDFSGGWRMRVALARALFIRPFML
Target-Kategorie: ABCF2
Application Verdünnung: WB: WB,1:500 - 1:1000