SLC25A13 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12557S
Artikelname: SLC25A13 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12557S
Hersteller Artikelnummer: CNA12557S
Alternativnummer: MBL-CNA12557S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human SLC25A13 (NP_001153682.1).
Konjugation: Unconjugated
Alternative Synonym: CTLN2, NICCD, CITRIN, ARALAR2
Klonalität: Polyclonal
Molekulargewicht: 74kDa
NCBI: 10165
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKDGLISFQEFVAFESVLCAPDALFMVAFQLFDKAGKGEVTFEDVKQVFGQTTIHQHIPFNWDSEFVQLHFGKERKRHLTYAEFTQFLLEIQLEHAKQAFVQRDNARTGRVTAIDFRDIMVTIRPHVLTPFVEECLVAAAGGTTSHQVSFSYFNGFNSLLNNMELIRKIYSTLAGTRKDVEVTKEEF
Target-Kategorie: SLC25A13
Application Verdünnung: WB: WB,1:500 - 1:1000