GABARAP Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12568S
Artikelname: GABARAP Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12568S
Hersteller Artikelnummer: CNA12568S
Alternativnummer: MBL-CNA12568S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GABARAP (NP_009209.1).
Konjugation: Unconjugated
Alternative Synonym: MM46, ATG8A, GABARAP-a
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 11337
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
Target-Kategorie: GABARAP
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200