[KO Validated] HP1 alpha/CBX5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12577S
Artikelname: [KO Validated] HP1 alpha/CBX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12577S
Hersteller Artikelnummer: CNA12577S
Alternativnummer: MBL-CNA12577S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human HP1 alpha/HP1 alpha/CBX5 (NP_001120794.1).
Konjugation: Unconjugated
Alternative Synonym: HP1, HP1A, HEL25
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 23468
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD
Target-Kategorie: CBX5
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200