KCNK9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12583S
Artikelname: KCNK9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12583S
Hersteller Artikelnummer: CNA12583S
Alternativnummer: MBL-CNA12583S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 265-374 of human KCNK9 (NP_001269463.1).
Konjugation: Unconjugated
Alternative Synonym: KT3.2, TASK3, BIBARS, K2p9.1, TASK-3, TASK32
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 51305
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: AGNRNSMVIHIPEEPRPSRPRYKADVPDLQSVCSCTCYRSQDYGGRSVAPQNSFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSFTDHQRLMKRRKSV
Target-Kategorie: KCNK9
Application Verdünnung: WB: WB,1:500 - 1:2000