UQCR10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12587S
Artikelname: UQCR10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12587S
Hersteller Artikelnummer: CNA12587S
Alternativnummer: MBL-CNA12587S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-63 of human UQCR10 (NP_037519.2).
Konjugation: Unconjugated
Alternative Synonym: QCR9, UCRC, HSPC051, HSPC119, HSPC151, UCCR7.2
Klonalität: Polyclonal
Molekulargewicht: 7kDa
NCBI: 29796
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK
Target-Kategorie: UQCR10
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200