ASAH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12596S
Artikelname: ASAH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12596S
Hersteller Artikelnummer: CNA12596S
Alternativnummer: MBL-CNA12596S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 80-340 of human ASAH2 (NP_001137446.1).
Konjugation: Unconjugated
Alternative Synonym: HNAC1, BCDase, LCDase, NCDase, N-CDase
Klonalität: Polyclonal
Molekulargewicht: 86kDa
NCBI: 56624
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: TATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKG
Target-Kategorie: ASAH2
Application Verdünnung: WB: WB,1:500 - 1:2000