DNAL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12601S
Artikelname: DNAL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12601S
Hersteller Artikelnummer: CNA12601S
Alternativnummer: MBL-CNA12601S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 41-190 of human DNAL1 (NP_113615.2).
Konjugation: Unconjugated
Alternative Synonym: LC1, CILD16, C14orf168
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 83544
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: DASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
Target-Kategorie: DNAL1
Application Verdünnung: WB: WB,1:500 - 1:2000