RASSF5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12602S
Artikelname: RASSF5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12602S
Hersteller Artikelnummer: CNA12602S
Alternativnummer: MBL-CNA12602S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human RASSF5 (NP_872606.1).
Konjugation: Unconjugated
Alternative Synonym: RAPL, Maxp1, NORE1, NORE1A, NORE1B, RASSF3
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 83593
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MTVDSSMSSGYCSLDEELEDCFFTAKTTFFRNAQSKHLSKNVCKPVEETQRPPTLQEIKQKIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKRIHKDGQVLFQKLSIADRPLYLRLLAGPDTEVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLE
Target-Kategorie: RASSF5
Application Verdünnung: WB: WB,1:500 - 1:2000