SLC32A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12610S
Artikelname: SLC32A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12610S
Hersteller Artikelnummer: CNA12610S
Alternativnummer: MBL-CNA12610S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human SLC32A1 (NP_542119.1).
Konjugation: Unconjugated
Alternative Synonym: VGAT, VIAAT
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 140679
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQMDILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
Target-Kategorie: SLC32A1
Application Verdünnung: WB: WB,1:500 - 1:2000