Occludin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12621P
Artikelname: Occludin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12621P
Hersteller Artikelnummer: CNA12621P
Alternativnummer: MBL-CNA12621P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human Occludin (NP_002529.1).
Konjugation: Unconjugated
Alternative Synonym: BLCPMG, PTORCH1, PPP1R115
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 100506658
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: VVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSEL
Target-Kategorie: OCLN
Application Verdünnung: WB: WB,1:1000 - 1:5000