MICA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12622S
Artikelname: MICA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12622S
Hersteller Artikelnummer: CNA12622S
Alternativnummer: MBL-CNA12622S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 24-307 of human MICA (NP_000238.1).
Konjugation: Unconjugated
Alternative Synonym: MIC-A, PERB11.1
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 100507436
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEE
Target-Kategorie: MICA
Application Verdünnung: WB: WB,1:500 - 1:2000