CD90/Thy1 Rabbit mAb, Clone: [ARC2609], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12623S
Artikelname: CD90/Thy1 Rabbit mAb, Clone: [ARC2609], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12623S
Hersteller Artikelnummer: CNA12623S
Alternativnummer: MBL-CNA12623S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD90/Thy1 (P04216).
Konjugation: Unconjugated
Alternative Synonym: CD90, CDw90
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2609]
Molekulargewicht: 18kDa
NCBI: 7070
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEG
Target-Kategorie: THY1
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200