TDG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1262S
Artikelname: TDG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1262S
Hersteller Artikelnummer: CNA1262S
Alternativnummer: MBL-CNA1262S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human TDG (NP_003202.3).
Konjugation: Unconjugated
Alternative Synonym: hTDG
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 6996
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFW
Target-Kategorie: TDG
Application Verdünnung: WB: WB,1:500 - 1:2000