NUCB2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12641T
Artikelname: NUCB2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12641T
Hersteller Artikelnummer: CNA12641T
Alternativnummer: MBL-CNA12641T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 321-420 of human NUCB2 (NP_005004.1).
Konjugation: Unconjugated
Alternative Synonym: NEFA, HEL-S-109
Klonalität: Polyclonal
Molekulargewicht: 50kDa
NCBI: 4925
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ATEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
Target-Kategorie: NUCB2
Application Verdünnung: WB: WB,1:500 - 1:2000