PRPS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12644T
Artikelname: PRPS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12644T
Hersteller Artikelnummer: CNA12644T
Alternativnummer: MBL-CNA12644T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PRPS2 (NP_002756.1).
Konjugation: Unconjugated
Alternative Synonym: PRSII
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 5634
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRGEDVYIIQSGCGEINDNLMELLIMINACKIASSSRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQGFFDIPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAG
Target-Kategorie: PRPS2
Application Verdünnung: WB: WB,1:1000 - 1:2000