WWOX Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12653T
Artikelname: WWOX Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12653T
Hersteller Artikelnummer: CNA12653T
Alternativnummer: MBL-CNA12653T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human WWOX (NP_057457.1).
Konjugation: Unconjugated
Alternative Synonym: FOR, WOX1, DEE28, EIEE28, FRA16D, SCAR12, HHCMA56, PRO0128, SDR41C1, D16S432E
Klonalität: Polyclonal
Molekulargewicht: 47kDa
NCBI: 51741
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGR
Target-Kategorie: WWOX
Application Verdünnung: WB: WB,1:1000 - 1:2000