BRWD1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12656T
Artikelname: BRWD1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12656T
Hersteller Artikelnummer: CNA12656T
Alternativnummer: MBL-CNA12656T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human BRWD1 (NP_001007247.1).
Konjugation: Unconjugated
Alternative Synonym: N143, WDR9, WRD9, DCAF19, C21orf107
Klonalität: Polyclonal
Molekulargewicht: 263kDa
NCBI: 54014
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSNKHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLGAGRQSLLRTAKGTLI
Target-Kategorie: BRWD1
Application Verdünnung: WB: WB,1:1000 - 1:3000