IFT74 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12672T
Artikelname: IFT74 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12672T
Hersteller Artikelnummer: CNA12672T
Alternativnummer: MBL-CNA12672T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-372 of human IFT74 (NP_001092694.1).
Konjugation: Unconjugated
Alternative Synonym: CMG1, BBS22, CCDC2, CMG-1, JBTS40, SPGF58
Klonalität: Polyclonal
Molekulargewicht: 69kDa
NCBI: 80173
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASNHKSSAARPVSRGGVGLTGRPPSGIRPLSGNIRVATAMPPGTARPGSRGCPIGTGGVLSSQIKVAHRPVTQQGLTGMKTGTKGPQRQILDKSYYLGLLRSKISELTTEVNKLQKGIEMYNQENSVYLSYEKRAETLAVEIKELQGQLADYNMLVDKLNTNTEMEEVMNDYNMLKAQNDRETQSLDVIFTERQAKEKQIRSVEEEIEQEKQATDDIIKNMSFENQVKYLEMKTTNEKLLQELDTLQQQLDSQ
Target-Kategorie: IFT74
Application Verdünnung: WB: WB,1:1000 - 1:3000