SLC1A5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12676S
Artikelname: SLC1A5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12676S
Hersteller Artikelnummer: CNA12676S
Alternativnummer: MBL-CNA12676S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC1A5 (NP_005619.1).
Konjugation: Unconjugated
Alternative Synonym: R16, AAAT, ATBO, M7V1, RDRC, ASCT2, M7VS1
Klonalität: Polyclonal
Molekulargewicht: 57kDa
NCBI: 6510
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLL
Target-Kategorie: SLC1A5
Application Verdünnung: WB: WB,1:500 - 1:2000