AREG Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12680P
Artikelname: AREG Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12680P
Hersteller Artikelnummer: CNA12680P
Alternativnummer: MBL-CNA12680P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF
Spezies Reaktivität: Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-252 of human AREG (NP_001648.1).
Konjugation: Unconjugated
Alternative Synonym: AR, SDGF, AREGB, CRDGF
Klonalität: Polyclonal
Molekulargewicht: 28kDa
NCBI: 374
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA
Target-Kategorie: AREG
Application Verdünnung: WB: IF/ICC,1:50 - 1:200