[KO Validated] MEK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12687T
Artikelname: [KO Validated] MEK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12687T
Hersteller Artikelnummer: CNA12687T
Alternativnummer: MBL-CNA12687T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1).
Konjugation: Unconjugated
Alternative Synonym: MEL, CFC3, MEK1, MKK1, MAPKK1, PRKMK1
Klonalität: Polyclonal
Molekulargewicht: 43kDa
NCBI: 5604
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH
Target-Kategorie: MAP2K1
Application Verdünnung: WB: WB,1:1000 - 1:3000|IHC-P,1:50 - 1:200