TFPI Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12692T
Artikelname: TFPI Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12692T
Hersteller Artikelnummer: CNA12692T
Alternativnummer: MBL-CNA12692T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-224 of human TFPI (NP_001027452.1).
Konjugation: Unconjugated
Alternative Synonym: EPI, TFI, LACI, TFPI1
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 7035
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFVTKEGTNDGWKNAAH
Target-Kategorie: TFPI
Application Verdünnung: WB: WB,1:1000 - 1:2000