Sonic Hedgehog (Shh) Rabbit mAb, Clone: [ARC0701], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA12695S
Artikelname: Sonic Hedgehog (Shh) Rabbit mAb, Clone: [ARC0701], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA12695S
Hersteller Artikelnummer: CNA12695S
Alternativnummer: MBL-CNA12695S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Sonic Hedgehog (Shh) (Q15465).
Konjugation: Unconjugated
Alternative Synonym: TPT, HHG1, HLP3, HPE3, SMMCI, ShhNC, TPTPS, MCOPCB5
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC0701]
Molekulargewicht: 50kDa
NCBI: 6469
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLTFLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
Target-Kategorie: SHH
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200