PSME3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12697T
Artikelname: PSME3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12697T
Hersteller Artikelnummer: CNA12697T
Alternativnummer: MBL-CNA12697T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human PSME3 (NP_005780.2).
Konjugation: Unconjugated
Alternative Synonym: Ki, PA28G, HEL-S-283, PA28gamma, REG-GAMMA, PA28-gamma
Klonalität: Polyclonal
Molekulargewicht: 30kDa
NCBI: 10197
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: KVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Target-Kategorie: PSME3
Application Verdünnung: WB: WB,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200