ACKR3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12712P
Artikelname: ACKR3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12712P
Hersteller Artikelnummer: CNA12712P
Alternativnummer: MBL-CNA12712P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human ACKR3 (NP_064707.1).
Konjugation: Unconjugated
Alternative Synonym: RDC1, CXCR7, RDC-1, CMKOR1, CXC-R7, CXCR-7, GPR159
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 57007
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: TNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSS
Target-Kategorie: ACKR3
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200