LHX9 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12717T
Artikelname: LHX9 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12717T
Hersteller Artikelnummer: CNA12717T
Alternativnummer: MBL-CNA12717T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human LHX9 (NP_064589.2).
Konjugation: Unconjugated
Alternative Synonym: LHX9
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 56956
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MEIVGCRAEDNSCPFRPPAMLFHGISGGHIQGIMEEMERRSKTEARLAKGAQLNGRDAGMPPLSPEKPAL
Target-Kategorie: LHX9
Application Verdünnung: WB: WB,1:500 - 1:2000