MOGS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12725T
Artikelname: MOGS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12725T
Hersteller Artikelnummer: CNA12725T
Alternativnummer: MBL-CNA12725T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-320 of human MOGS (NP_006293.2).
Konjugation: Unconjugated
Alternative Synonym: DER7, GCS1, CDG2B, CWH41
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 7841
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: RWVLAWYRARRAVTLHSAPPVLPADSSSPAVAPDLFWGTYRPHVYFGMKTRSPKPLLTGLMWAQQGTTPGTPKLRHTCEQGDGVGPYGWEFHDGLSFGRQHIQDGALRLTTEFVKRPGGQHGGDWSWRVTVEPQDSGTSALPLVSLFFYVVTDGKEVLLPEVGAKGQLKFISGHTSELGDFRFTLLPPTSPGDTAPKYGSYNVFWTSNPGLPLLTEMVKSRLNSWFQHRPPGAPPERYLGLPGSLKWEDRGPSG
Target-Kategorie: MOGS
Application Verdünnung: WB: WB,1:500 - 1:2000