LSM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12732T
Artikelname: LSM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12732T
Hersteller Artikelnummer: CNA12732T
Alternativnummer: MBL-CNA12732T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human LSM1 (NP_055277.1).
Konjugation: Unconjugated
Alternative Synonym: CASM, YJL124C
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 27257
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGENVVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
Target-Kategorie: LSM1
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200