ACE2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12737P
Artikelname: ACE2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12737P
Hersteller Artikelnummer: CNA12737P
Alternativnummer: MBL-CNA12737P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ACE2 (NP_068576.1).
Konjugation: Unconjugated
Alternative Synonym: ACEH
Klonalität: Polyclonal
Molekulargewicht: 92kDa
NCBI: 59272
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: GDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
Target-Kategorie: ACE2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200