UQCRB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA1273S
Artikelname: UQCRB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA1273S
Hersteller Artikelnummer: CNA1273S
Alternativnummer: MBL-CNA1273S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human UQCRB (NP_006285.1).
Konjugation: Unconjugated
Alternative Synonym: QPC, QCR7, QP-C, UQBC, UQBP, UQPC, UQCR6, MC3DN3
Klonalität: Polyclonal
Molekulargewicht: 14kDa
NCBI: 7381
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
Target-Kategorie: UQCRB
Application Verdünnung: WB: WB,1:1000 - 1:2000