COPS8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12745T
Artikelname: COPS8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12745T
Hersteller Artikelnummer: CNA12745T
Alternativnummer: MBL-CNA12745T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-209 of human COPS8 (NP_006701.1).
Konjugation: Unconjugated
Alternative Synonym: COP9, CSN8, SGN8
Klonalität: Polyclonal
Molekulargewicht: 23kDa
NCBI: 10920
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Target-Kategorie: COPS8
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200