Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12756P
Artikelname: Tyrosine Hydroxylase Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12756P
Hersteller Artikelnummer: CNA12756P
Alternativnummer: MBL-CNA12756P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2).
Konjugation: Unconjugated
Alternative Synonym: TYH, DYT14, DYT5b
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 7054
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
Target-Kategorie: TH
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200