NUP35 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12762T
Artikelname: NUP35 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12762T
Hersteller Artikelnummer: CNA12762T
Alternativnummer: MBL-CNA12762T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-326 of human NUP35 (NP_612142.2).
Konjugation: Unconjugated
Alternative Synonym: MP44, NP44, MP-44, NUP53
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 129401
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVGVMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGVKPCIDKSVMESSDR
Target-Kategorie: NUP35
Application Verdünnung: WB: WB,1:500 - 1:2000