PEBP1 Rabbit mAb, Clone: [ARC0704], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA12768S
| Artikelname: |
PEBP1 Rabbit mAb, Clone: [ARC0704], Unconjugated, Monoclonal |
| Artikelnummer: |
MBL-CNA12768S |
| Hersteller Artikelnummer: |
CNA12768S |
| Alternativnummer: |
MBL-CNA12768S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PEBP1 (P30086). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
PBP, HCNP, PEBP, RKIP, HCNPpp, PEBP-1, HEL-210, HEL-S-34, HEL-S-96 |
| Klonalität: |
Monoclonal |
| Klon-Bezeichnung: |
[ARC0704] |
| Molekulargewicht: |
21kDa |
| NCBI: |
5037 |
| Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
| Sequenz: |
MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSG |
| Target-Kategorie: |
PEBP1 |
| Application Verdünnung: |
WB: WB,1:500 - 1:2000 |
