CLPS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12772T
Artikelname: CLPS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12772T
Hersteller Artikelnummer: CNA12772T
Alternativnummer: MBL-CNA12772T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human CLPS (NP_001823.1).
Konjugation: Unconjugated
Alternative Synonym: CLPS,colipase
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 1208
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: ALGLARCTSMASENSECSVKTLYGIYYKCPCERGLTCEGDKTIVGSITNTNFGICHDAGRSKQ
Target-Kategorie: CLPS
Application Verdünnung: WB: WB,1:500 - 1:2000