ADIPOR2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12777P
Artikelname: ADIPOR2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12777P
Hersteller Artikelnummer: CNA12777P
Alternativnummer: MBL-CNA12777P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human ADIPOR2 (NP_078827.2).
Konjugation: Unconjugated
Alternative Synonym: PAQR2, ACDCR2
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 79602
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETG
Target-Kategorie: ADIPOR2
Application Verdünnung: WB: WB,1:100 - 1:500