TET2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA12779S
| Artikelname: |
TET2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
MBL-CNA12779S |
| Hersteller Artikelnummer: |
CNA12779S |
| Alternativnummer: |
MBL-CNA12779S |
| Hersteller: |
MBL |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1833-2002 of human TET2 (NP_001120680.1). |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
MDS, IMD75, KIAA1546 |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
224kDa |
| NCBI: |
54790 |
| Puffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Quelle: |
Rabbit |
| Reinheit: |
Affinity purification |
| Formulierung: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequenz: |
VQGVASGAEDNDEVWSDSEQSFLDPDIGGVAVAPTHGSILIECAKRELHATTPLKNPNRNHPTRISLVFYQHKSMNEPKHGLALWEAKMAEKAREKEEECEKYGPDYVPQKSHGKKVKREPAEPHETSEPTYLRFIKSLAERTMSVTTDSTVTTSPYAFTRVTGPYNRYI |
| Target-Kategorie: |
TET2 |
| Application Verdünnung: |
WB: WB,1:1000 - 1:2000 |
