BMP2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12781S
Artikelname: BMP2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12781S
Hersteller Artikelnummer: CNA12781S
Alternativnummer: MBL-CNA12781S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human BMP2 (NP_001191.1).
Konjugation: Unconjugated
Alternative Synonym: BDA2, BMP2A, SSFSC, SSFSC1
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 650
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSMFGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLE
Target-Kategorie: BMP2
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200