ACTN3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12797T
Artikelname: ACTN3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12797T
Hersteller Artikelnummer: CNA12797T
Alternativnummer: MBL-CNA12797T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 580-630 of human ACTN3 (NP_001095.2).
Konjugation: Unconjugated
Alternative Synonym: ACTN3D
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 89
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTKWDMVRKLVPSCDQ
Target-Kategorie: ACTN3
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500