ANGEL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12799T
Artikelname: ANGEL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12799T
Hersteller Artikelnummer: CNA12799T
Alternativnummer: MBL-CNA12799T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-170 of human ANGEL2 (NP_653168.2).
Konjugation: Unconjugated
Alternative Synonym: Ccr4d, KIAA0759L
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 90806
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: SLGRDWTTPWENLQRCCWNRHISSCMRWPGHYSRAPYPYFSSRHFSLNWRPPCLFESRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNWEYICSHDKEKTKILGDKNVDPKCEDSENKFDFSVM
Target-Kategorie: ANGEL2
Application Verdünnung: WB: WB,1:500 - 1:2000