MRPL42 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12811T
Artikelname: MRPL42 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12811T
Hersteller Artikelnummer: CNA12811T
Alternativnummer: MBL-CNA12811T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human MRPL42 (NP_054769.1).
Konjugation: Unconjugated
Alternative Synonym: L31MT, L42MT, S32MT, MRPL31, MRPS32, PTD007, RPML31, HSPC204, MRP-L31, MRP-L42, MRP-S32
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 28977
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MAVAAVKWVMSKRTILKHLFPVQNGALYCVCHKSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDIPYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEHLEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLNPPKDR
Target-Kategorie: MRPL42
Application Verdünnung: WB: WB,1:1000 - 1:2000