Olig2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12814T
Artikelname: Olig2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12814T
Hersteller Artikelnummer: CNA12814T
Alternativnummer: MBL-CNA12814T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Olig2 (NP_005797.1).
Konjugation: Unconjugated
Alternative Synonym: BHLHB1, OLIGO2, RACK17, PRKCBP2, bHLHe19
Klonalität: Polyclonal
Molekulargewicht: 32kDa
NCBI: 10215
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDSDASLVSSRPSSPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQ
Target-Kategorie: OLIG2
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:100