PARP10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12815T
Artikelname: PARP10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12815T
Hersteller Artikelnummer: CNA12815T
Alternativnummer: MBL-CNA12815T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human PARP10 (NP_116178.2).
Konjugation: Unconjugated
Alternative Synonym: ARTD10
Klonalität: Polyclonal
Molekulargewicht: 110kDa
NCBI: 84875
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MVAMAEAEAGVAVEVRGLPPAVPDELLTLYFENRRRSGGGPVLSWQRLGCGGVLTFREPADAERVLAQADHELHGAQLSLRPAPPRAPARLLLQGLPPGTTPQRLEQHVQALLRASGLPVQPCCALASPRPDRALVQLPKPLSEADVRVLEEQAQNLGLEGTLVSLARVPQARAVRVVGDGASVDLLLLELYLENERRSGGGPLEDLQRLPGPLGTVASFQQWQVAERVLQQEHRLQGSELSLVPHYDILEPEE
Target-Kategorie: PARP10
Application Verdünnung: WB: WB,1:500 - 1:2000