TCL1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12822T
Artikelname: TCL1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12822T
Hersteller Artikelnummer: CNA12822T
Alternativnummer: MBL-CNA12822T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human TCL1B (NP_004909.1).
Konjugation: Unconjugated
Alternative Synonym: TML1, SYN-1
Klonalität: Polyclonal
Molekulargewicht: 15kDa
NCBI: 9623
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSITVHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVLTYQPERKD
Target-Kategorie: TCL1B
Application Verdünnung: WB: WB,1:500 - 1:1000