CDK11B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA12830T
Artikelname: CDK11B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA12830T
Hersteller Artikelnummer: CNA12830T
Alternativnummer: MBL-CNA12830T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human CDK11B (NP_277021.2).
Konjugation: Unconjugated
Alternative Synonym: p58, PK58, CDK11, CLK-1, CDC2L1, PITSLREA, p58CLK-1, CDK11-p46, CDK11-p58, p58CDC2L1, CDK11-p110
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 984
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MGDEKDSWKVKTLDEILQEKKRRKEQEEKAEIKRLKNSDDRDSKRDSLEEGELRDHRMEITIRNSPYRREDSMEDRGEEDDSLAIKPPQQMSRKEKAHHRKDEKRKEKRRHRSHSAEGGKHARVKEKERE
Target-Kategorie: CDK11B
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200